PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_068F5C18A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 582aa    MW: 68627.6 Da    PI: 8.3663
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_068F5C18A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR144.64.6e-144633091
                   FAR1 30 krtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                           k ++ C+++gk++ + +  +++r++++ ++t+C+ak+ vk++ +g+we t++++eHnH+l+p
  Traes_5AS_068F5C18A.1  4 KFHLICNRSGKSRATPDL-QRKRKRKSIEKTNCQAKVIVKLT-KGQWEFTTVRNEHNHPLCP 63
                           56789********99988.99999******************.9****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.1E-12463IPR004330FAR1 DNA binding domain
PfamPF105511.1E-27185276IPR018289MULE transposase domain
PROSITE profilePS509669.124467503IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MRKKFHLICN RSGKSRATPD LQRKRKRKSI EKTNCQAKVI VKLTKGQWEF TTVRNEHNHP  60
LCPSASLTKF YLSHKHISTE ERSFLKVLQR TRIPPNKVMK IFRRMRGSFG SIPFKKKDGT  120
NLLCIEQHRK ENSDVGRMLM YFKEKELQDP SFQCMKQTDE DNIVRSVFWT DARSRMDYEI  180
FGDFLLFDTT YTTDRHHMLF APIIGINNHG RTLLLGCALL HDESAETYKW MFETLLHVME  240
DKMPVSIITN QDEAMAKAIG EVMPQVRHRL CKWDVLEKAQ QNISAFIAES GNIKADLNSL  300
IDNSLTEKEF EEGWDALIER YGASENEYLQ LLWQRRKNWV PVYFREDFYP FVQSHGCDEG  360
MNLLFNDYVL SIDRIEKFIE RYEEIHKNIT KTDEEDRLQT GTVPLCFSLQ PIEKHAADIY  420
TRQIFLKVQR ELLHSTAFNV QEVQRGAVYR LNKVFSYENP EFDQNNFEVQ VESGTNAFKC  480
QCAKFTRDGI LCCHIFRLFT QFGINQIPEQ YIVPRWTEKF REEKEKQYKK KCSEQMDTTM  540
RYTNFMTKMA DLGKTICSDG AKYDAFMLEV DKIQVNFATA QK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12227RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3601620.0AK360162.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1111O12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234143.20.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
TrEMBLA0A096US390.0A0A096US39_WHEAT; Uncharacterized protein
STRINGMLOC_75367.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-78FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]